6.9 sec in total
663 ms
6.2 sec
131 ms
Visit srikanchimahaswamividyamandir.edu.in now to see the best up-to-date Sri Kanchi Mahaswami Vidya Mandir Edu content and also check out these interesting facts you probably never knew about srikanchimahaswamividyamandir.edu.in
Sri Kanchi Mahaswami Vidya Mandir CBSE School, Chennai, Welcome to Sri Kanchi Mahaswami Vidya Mandir, a unique school, from Sri Kanchi Mahaswami Trust.
Visit srikanchimahaswamividyamandir.edu.inWe analyzed Srikanchimahaswamividyamandir.edu.in page load time and found that the first response time was 663 ms and then it took 6.3 sec to load all DOM resources and completely render a web page. This is a poor result, as 80% of websites can load faster.
srikanchimahaswamividyamandir.edu.in performance score
name
value
score
weighting
Value2.8 s
55/100
10%
Value2.8 s
82/100
25%
Value6.4 s
40/100
10%
Value0 ms
100/100
30%
Value0
100/100
15%
Value2.8 s
97/100
10%
663 ms
863 ms
653 ms
1142 ms
450 ms
Our browser made a total of 36 requests to load all elements on the main page. We found that all of those requests were addressed to Srikanchimahaswamividyamandir.edu.in and no external sources were called. The less responsive or slowest element that took the longest time to load (1.5 sec) belongs to the original domain Srikanchimahaswamividyamandir.edu.in.
Page size can be reduced by 141.1 kB (23%)
626.2 kB
485.1 kB
In fact, the total size of Srikanchimahaswamividyamandir.edu.in main page is 626.2 kB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 20% of websites need less resources to load. Images take 436.1 kB which makes up the majority of the site volume.
Potential reduce by 19.6 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 19.6 kB or 69% of the original size.
Potential reduce by 4.3 kB
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. Sri Kanchi Mahaswami Vidya Mandir Edu images are well optimized though.
Potential reduce by 106.3 kB
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. It is highly recommended that all JavaScript files should be compressed and minified as it can save up to 106.3 kB or 72% of the original size.
Potential reduce by 10.9 kB
CSS files minification is very important to reduce a web page rendering time. The faster CSS files can load, the earlier a page can be rendered. Srikanchimahaswamividyamandir.edu.in needs all CSS files to be minified and compressed as it can save up to 10.9 kB or 77% of the original size.
Number of requests can be reduced by 14 (52%)
27
13
The browser has sent 27 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Sri Kanchi Mahaswami Vidya Mandir Edu. We recommend that multiple CSS and JavaScript files should be merged into one by each type, as it can help reduce assets requests from 6 to 1 for JavaScripts and from 4 to 1 for CSS and as a result speed up the page load time.
{{url}}
{{time}} ms
srikanchimahaswamividyamandir.edu.in accessibility score
Contrast
These are opportunities to improve the legibility of your content.
Impact
Issue
Background and foreground colors do not have a sufficient contrast ratio.
Navigation
These are opportunities to improve keyboard navigation in your application.
Impact
Issue
[id] attributes on active, focusable elements are not unique
Internationalization and localization
These are opportunities to improve the interpretation of your content by users in different locales.
Impact
Issue
<html> element does not have a [lang] attribute
Names and labels
These are opportunities to improve the semantics of the controls in your application. This may enhance the experience for users of assistive technology, like a screen reader.
Impact
Issue
Image elements do not have [alt] attributes
Links do not have a discernible name
Tables and lists
These are opportunities to improve the experience of reading tabular or list data using assistive technology, like a screen reader.
Impact
Issue
Lists do not contain only <li> elements and script supporting elements (<script> and <template>).
srikanchimahaswamividyamandir.edu.in best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Includes front-end JavaScript libraries with known security vulnerabilities
Ensure CSP is effective against XSS attacks
User Experience
Impact
Issue
Displays images with incorrect aspect ratio
Serves images with low resolution
General
Impact
Issue
Detected JavaScript libraries
Browser errors were logged to the console
Issues were logged in the Issues panel in Chrome Devtools
srikanchimahaswamividyamandir.edu.in SEO score
Crawling and Indexing
To appear in search results, crawlers need access to your app.
Impact
Issue
Links are not crawlable
Content Best Practices
Format your HTML in a way that enables crawlers to better understand your app’s content.
Impact
Issue
Image elements do not have [alt] attributes
EN
N/A
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Srikanchimahaswamividyamandir.edu.in can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and neither this language nor any other was claimed in <html> or <meta> tags. Our system also found out that Srikanchimahaswamividyamandir.edu.in main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
srikanchimahaswamividyamandir.edu.in
Open Graph description is not detected on the main page of Sri Kanchi Mahaswami Vidya Mandir Edu. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: