Report Summary

  • 0

    Performance

  • 0

    Accessibility

  • 0

    Best Practices

  • 0

    SEO

siddhivinayakprecastchemicals.com

Interlocking Paver & Interlocking Tiles Admixture and Construction Chemicals Manufacturer | Siddhi Vinayak Precast Chemicals Private Limited, Satna

Page Load Speed

2.3 sec in total

First Response

878 ms

Resources Loaded

1.2 sec

Page Rendered

227 ms

About Website

Click here to check amazing Siddhi Vinayak Precast Chemicals content. Otherwise, check out these important facts you probably never knew about siddhivinayakprecastchemicals.com

Siddhi Vinayak Precast Chemicals Private Limited - Interlocking Paver & Interlocking Tiles Admixture, Construction Chemicals & Flyash Brick & Concrete Blocks Hardener Manufacturer from Satna, Madhya P...

Visit siddhivinayakprecastchemicals.com

Key Findings

We analyzed Siddhivinayakprecastchemicals.com page load time and found that the first response time was 878 ms and then it took 1.5 sec to load all DOM resources and completely render a web page. This is quite a good result, as only 30% of websites can load faster.

Performance Metrics

siddhivinayakprecastchemicals.com performance score

0

Network Requests Diagram

siddhivinayakprecastchemicals.com

878 ms

www.siddhivinayakprecastchemicals.com

97 ms

www.siddhivinayakprecastchemicals.com

215 ms

Our browser made a total of 3 requests to load all elements on the main page. We found that all of those requests were addressed to Siddhivinayakprecastchemicals.com and no external sources were called. The less responsive or slowest element that took the longest time to load (878 ms) belongs to the original domain Siddhivinayakprecastchemicals.com.

Page Optimization Overview & Recommendations

Page size can be reduced by 53 B (30%)

Content Size

177 B

After Optimization

124 B

In fact, the total size of Siddhivinayakprecastchemicals.com main page is 177 B. This result falls within the top 5000 of lightweight and thus fast loading web pages. Only a small number of websites need less resources to load. HTML takes 177 B which makes up the majority of the site volume.

HTML Optimization

-30%

Potential reduce by 53 B

  • Original 177 B
  • After minification 165 B
  • After compression 124 B

HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 53 B or 30% of the original size.

Requests Breakdown

We found no issues to fix!

Requests Now

0

After Optimization

0

Besides the initial HTML request, no CSS, Javascripts, AJAX or image files were requested in the course of web page rendering.

SEO Factors

siddhivinayakprecastchemicals.com SEO score

0

Language and Encoding

  • Language Detected

    EN

  • Language Claimed

    N/A

  • Encoding

    ISO-8859-1

Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Siddhivinayakprecastchemicals.com can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and neither this language nor any other was claimed in <html> or <meta> tags. Our system also found out that Siddhivinayakprecastchemicals.com main page’s claimed encoding is iso-8859-1. Changing it to UTF-8 can be a good choice, as this format is commonly used for encoding all over the web and thus their visitors won’t have any troubles with symbol transcription or reading.

Social Sharing Optimization

Open Graph description is not detected on the main page of Siddhi Vinayak Precast Chemicals. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: