181 ms in total
46 ms
50 ms
85 ms
Visit unitedelectriciansmaplevalleywa.com now to see the best up-to-date Unitedelectriciansmaplevalleywa content and also check out these interesting facts you probably never knew about unitedelectriciansmaplevalleywa.com
Visit unitedelectriciansmaplevalleywa.comWe analyzed Unitedelectriciansmaplevalleywa.com page load time and found that the first response time was 46 ms and then it took 135 ms to load all DOM resources and completely render a web page. This is an excellent result, as only a small number of websites can load faster.
unitedelectriciansmaplevalleywa.com performance score
name
value
score
weighting
Value3.1 s
46/100
10%
Value3.3 s
70/100
25%
Value3.1 s
93/100
10%
Value10 ms
100/100
30%
Value0.033
100/100
15%
Value3.3 s
94/100
10%
46 ms
4 ms
Our browser made a total of 2 requests to load all elements on the main page. We found that all of those requests were addressed to Unitedelectriciansmaplevalleywa.com and no external sources were called. The less responsive or slowest element that took the longest time to load (46 ms) belongs to the original domain Unitedelectriciansmaplevalleywa.com.
Page size can be reduced by 324 B (0%)
196.2 kB
195.8 kB
In fact, the total size of Unitedelectriciansmaplevalleywa.com main page is 196.2 kB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. Only 5% of websites need less resources to load. Images take 195.1 kB which makes up the majority of the site volume.
Potential reduce by 324 B
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 324 B or 29% of the original size.
Potential reduce by 0 B
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. Unitedelectriciansmaplevalleywa images are well optimized though.
We found no issues to fix!
1
1
The browser has sent 1 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Unitedelectriciansmaplevalleywa. According to our analytics all requests are already optimized.
{{url}}
{{time}} ms
unitedelectriciansmaplevalleywa.com accessibility score
Contrast
These are opportunities to improve the legibility of your content.
Impact
Issue
Background and foreground colors do not have a sufficient contrast ratio.
Names and labels
These are opportunities to improve the semantics of the controls in your application. This may enhance the experience for users of assistive technology, like a screen reader.
Impact
Issue
<frame> or <iframe> elements do not have a title
unitedelectriciansmaplevalleywa.com best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Ensure CSP is effective against XSS attacks
unitedelectriciansmaplevalleywa.com SEO score
Mobile Friendly
Make sure your pages are mobile friendly so users don’t have to pinch or zoom in order to read the content pages. [Learn more](https://developers.google.com/search/mobile-sites/).
Impact
Issue
Document uses legible font sizes
EN
EN
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Unitedelectriciansmaplevalleywa.com can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and it matches the claimed language. Our system also found out that Unitedelectriciansmaplevalleywa.com main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
unitedelectriciansmaplevalleywa.com
Open Graph description is not detected on the main page of Unitedelectriciansmaplevalleywa. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: