2.3 sec in total
878 ms
1.2 sec
227 ms
Click here to check amazing Siddhi Vinayak Precast Chemicals content. Otherwise, check out these important facts you probably never knew about siddhivinayakprecastchemicals.com
Siddhi Vinayak Precast Chemicals Private Limited - Interlocking Paver & Interlocking Tiles Admixture, Construction Chemicals & Flyash Brick & Concrete Blocks Hardener Manufacturer from Satna, Madhya P...
Visit siddhivinayakprecastchemicals.comWe analyzed Siddhivinayakprecastchemicals.com page load time and found that the first response time was 878 ms and then it took 1.5 sec to load all DOM resources and completely render a web page. This is quite a good result, as only 30% of websites can load faster.
siddhivinayakprecastchemicals.com performance score
878 ms
97 ms
215 ms
Our browser made a total of 3 requests to load all elements on the main page. We found that all of those requests were addressed to Siddhivinayakprecastchemicals.com and no external sources were called. The less responsive or slowest element that took the longest time to load (878 ms) belongs to the original domain Siddhivinayakprecastchemicals.com.
Page size can be reduced by 53 B (30%)
177 B
124 B
In fact, the total size of Siddhivinayakprecastchemicals.com main page is 177 B. This result falls within the top 5000 of lightweight and thus fast loading web pages. Only a small number of websites need less resources to load. HTML takes 177 B which makes up the majority of the site volume.
Potential reduce by 53 B
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 53 B or 30% of the original size.
We found no issues to fix!
0
0
Besides the initial HTML request, no CSS, Javascripts, AJAX or image files were requested in the course of web page rendering.
siddhivinayakprecastchemicals.com
878 ms
www.siddhivinayakprecastchemicals.com
97 ms
www.siddhivinayakprecastchemicals.com
215 ms
siddhivinayakprecastchemicals.com SEO score
EN
N/A
ISO-8859-1
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Siddhivinayakprecastchemicals.com can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and neither this language nor any other was claimed in <html> or <meta> tags. Our system also found out that Siddhivinayakprecastchemicals.com main page’s claimed encoding is iso-8859-1. Changing it to UTF-8 can be a good choice, as this format is commonly used for encoding all over the web and thus their visitors won’t have any troubles with symbol transcription or reading.
siddhivinayakprecastchemicals.com
Open Graph description is not detected on the main page of Siddhi Vinayak Precast Chemicals. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: